SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000480963 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000480963
Domain Number 1 Region: 330-350,381-565
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.37e-74
Family Fumble-like 0.0000000419
Further Details:      
 
Domain Number 2 Region: 211-355
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 9.93e-47
Family Fumble-like 0.000000445
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000480963   Gene: ENSG00000125779   Transcript: ENST00000610700
Sequence length 570
Comment pep:known chromosome:GRCh38:20:3889095:3923855:1 gene:ENSG00000125779 transcript:ENST00000610700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLGPFHPRVHWAAPPSLSSGLHRLLFLRGTRIPSSTTLSPPRHDSLSLDGGTVNPPRV
REPTGREAFGPSPASSDWLPARWRNGRGGRPRARLCSGWTAAEEARRNPTLGGLLGRQRL
LLRMGGGRLGAPMERHGRASATSVSSAGEQAAGDPEGRRQEPLRRRASSASVPAVGASAE
GTRRDRLGSYSGPTSVSRQRVESLRKKRPLFPWFGLDIGGTLVKLVYFEPKDITAEEEEE
EVESLKSIRKYLTSNVAYGSTGIRDVHLELKDLTLCGRKGNLHFIRFPTHDMPAFIQMGR
DKNFSSLHTVFCATGGGAYKFEQDFLTIGDLQLCKLDELDCLIKGILYIDSVGFNGRSQC
YYFENPADSEKCQKLPFDLKNPYPLLLVNIGSGVSILAVYSKDNYKRVTGTSLGGGTFFG
LCCLLTGCTTFEEALEMASRGDSTKVDKLVRDIYGGDYERFGLPGWAVASSFGNMMSKEK
REAVSKEDLARATLITITNNIGSIARMCALNENINQVVFVGNFLRINTIAMRLLAYALDY
WSKGQLKALFSEHEGYFGAVGALLELLKIP
Download sequence
Identical sequences Q9BZ23
NP_705902.2.87134 NP_705902.2.92137 ENSP00000313377 ENSP00000480963 ENSP00000417609 9606.ENSP00000313377 ENSP00000313377 gi|85838513|ref|NP_705902.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]