SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000481523 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000481523
Domain Number 1 Region: 39-59,90-274
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.59e-75
Family Fumble-like 0.0000000419
Further Details:      
 
Domain Number 2 Region: 1-64
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 5.44e-16
Family Fumble-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000481523   Gene: ENSG00000125779   Transcript: ENST00000621507
Sequence length 279
Comment pep:known chromosome:GRCh38:20:3889816:3923855:1 gene:ENSG00000125779 transcript:ENST00000621507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAFIQMGRDKNFSSLHTVFCATGGGAYKFEQDFLTIGDLQLCKLDELDCLIKGILYIDS
VGFNGRSQCYYFENPADSEKCQKLPFDLKNPYPLLLVNIGSGVSILAVYSKDNYKRVTGT
SLGGGTFFGLCCLLTGCTTFEEALEMASRGDSTKVDKLVRDIYGGDYERFGLPGWAVASS
FGNMMSKEKREAVSKEDLARATLITITNNIGSIARMCALNENINQVVFVGNFLRINTIAM
RLLAYALDYWSKGQLKALFSEHEGYFGAVGALLELLKIP
Download sequence
Identical sequences A0A2J8MSF2 A0A2J8RZW8 A0A2K5NZW1 A0A2K6KFI6 F6QZB9 F7DDR9
NP_001311120.1.87134 NP_001311120.1.92137 NP_079236.3.87134 NP_079236.3.92137 NP_705904.1.87134 NP_705904.1.92137 XP_002830113.2.23681 XP_005260893.3.92137 XP_010971045.1.22495 XP_015004932.1.72884 XP_015004933.1.72884 XP_015004934.1.72884 XP_015992092.1.101085 XP_015992177.1.101085 XP_016792874.1.37143 XP_016792875.1.37143 XP_016792876.1.37143 XP_017733671.1.44346 XP_017733688.1.44346 XP_017733697.1.44346 XP_020732732.1.74333 ENSMMUP00000026242 ENSMMUP00000026243 ENSP00000417609 ENSP00000481523 gi|24430167|ref|NP_079236.3| gi|24430175|ref|NP_705904.1| ENSCJAP00000039523 ENSP00000417609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]