SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000482040 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000482040
Domain Number 1 Region: 216-380
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-38
Family Dual specificity phosphatase-like 0.0000142
Further Details:      
 
Domain Number 2 Region: 392-521
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.6e-37
Family PLC-like (P variant) 0.001
Further Details:      
 
Domain Number 3 Region: 74-206
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000863
Family Voltage-gated potassium channels 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000482040   Gene: ENSG00000274391   Transcript: ENST00000622113
Sequence length 533
Comment pep:known chromosome:GRCh38:21:10521553:10606140:1 gene:ENSG00000274391 transcript:ENST00000622113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNESPDPTDLAGVIIELGPNDSPQTSEFKGATEEAPAKESVLARLSKFEVEDAENVASYD
SKIKKIVHSIVSSFAFGLFGVFLVLLDVTLILADLIFTDSKLYIPLEYRSISLAIALFFL
MDVLLRVFVERRQQYFSDLFNILDTAIIVILLLVDVVYIFFDIKLLRNIPRWTHLLRLLR
LIILLRIFHLFHQKRQLEKLIRRRVSENKRRYTRDGFDLDLTYVTERIIAMSFPSSGRQS
FYRNPIKEVVRFLDKKHRNHYRVYNLCSERAYDPKHFHNRVVRIMIDDHNVPTLHQMVVF
TKEVNEWMAQDLENIVAIHCKGGTDRTGTMVCAFLIASEICSTAKESLYYFGERRTDKTH
SEKFQGVKTPSQKRYVAYFAQVKHLYNWNLPPRRILFIKHFIIYSIPRYVRDLKIQIEME
KKVVFSTISLGKCSVLDNITTDKILIDVFDGLPLYDDVKVQFFYSNLPTYYDNCSFYFWL
HTSFIENNRLYLPKNELDNLHKQKARRIYPSDFAVEILFGEKMTSSDVVAGSD
Download sequence
Identical sequences ENSP00000482040 ENSP00000298232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]