SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000482099 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000482099
Domain Number 1 Region: 42-215
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-43
Family BCR-homology GTPase activation domain (BH-domain) 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000482099   Gene: ENSG00000274734   Transcript: ENST00000621228
Sequence length 267
Comment pep:known chromosome:GRCh38:CHR_HSCHR15_4_CTG8:30776860:30837039:1 gene:ENSG00000274734 transcript:ENST00000621228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWDQRLVKLALLQHLRAFYGIKVKGVRGQCDRRRHETAATEIGGKIFGVPFNALPHSAVP
EYGHIPSFLVDACTSLEEHIHTEGLFRKSGSVIRLKALKNKVDHGEGCLSSAPPCDIAGL
LKQFFRELPEPILPADLHEALLKAQQLGTEEKNKAILLLSCLLADHTVHVLRYFFNFLRN
VSLRSSENKMDSSNLAVIFAPNLLQTSEGHEKMSSNAEKKGVYQTLSWKRYQPCWVLMVS
VLLHHWKALKKVNMKLLVNIREREDNV
Download sequence
Identical sequences Q3KRB8
ENSP00000392760 ENSP00000457054 ENSP00000392760 9606.ENSP00000342291 NP_001034930.1.87134 NP_001034930.1.92137 ENSP00000392760 ENSP00000457054 ENSP00000481934 ENSP00000482099 gi|89886350|ref|NP_001034930.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]