SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000482149 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000482149
Domain Number 1 Region: 218-458
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.66e-82
Family Hexokinase 0.00000000058
Further Details:      
 
Domain Number 2 Region: 11-216
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.59e-76
Family Hexokinase 0.00000000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000482149   Gene: ENSG00000106633   Transcript: ENST00000616242
Sequence length 464
Comment pep:known chromosome:GRCh38:7:44144271:44158114:-1 gene:ENSG00000106633 transcript:ENST00000616242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRPRSQLPQPNSQVEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKMLPTY
VRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAEM
LFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNV
VGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYMEEMQNV
ELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRLVDESSANPGQQLYEKLIGGKYMGEL
VRLVLLRLVDENLLFHGEASEQLRTRGAFETRFVSQVESDTGDRKQIYNILSTLGLRPST
TDCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSFKE
RFHASVRRLTPSCEITFIESEEGSGRGAALVSAVACKKACMLGQ
Download sequence
Identical sequences A0A2J8L9J1
NP_277043.1.87134 NP_277043.1.92137 ENSP00000379142 ENSP00000482149 ENSP00000379142 gi|15967161|ref|NP_277043.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]