SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000482169 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000482169
Domain Number 1 Region: 318-395
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.74e-23
Family Intermediate filament protein, coiled coil region 0.0000878
Further Details:      
 
Domain Number 2 Region: 89-122
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000204
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000482169   Gene: ENSG00000277586   Transcript: ENST00000610854
Sequence length 543
Comment pep:known chromosome:GRCh38:8:24950955:24957110:-1 gene:ENSG00000277586 transcript:ENST00000610854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSS
SGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRFASFIERVHELEQQNKVLEA
ELLVLRQKHSEPSRFRALYEQEIRDLRLAAEDATNEKQALQGEREGLEETLRNLQARYEE
EVLSREDAEGRLMEARKGADEAALARAELEKRIDSLMDEISFLKKVHEEEIAELQAQIQY
AQISVEMDVTKPDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVRA
AKDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTINKLENELRT
TKSEMARYLKEYQDLLNVKMALDIEIAAYRKLLEGEETRLSFTSVGSITSGYSQSSQVFG
RSAYGGLQTSSYLMSTRSFPSYYTSHVQEEQIEVEETIEAAKAEEAKDEPPSEGEAEEEE
KDKEEAEEEEAAEEEEAAKEESEEAKEEEEGGEGEEGEETKEAEEEEKKVEGAGEEQAAK
KKD
Download sequence
Identical sequences A0A2I3SJH8 A0A2J8X4Z4 G3RNG2 P07196 Q5R408
ENSPPYP00000020675 ENSGGOP00000017329 gi|105990539|ref|NP_006149.2| ENSP00000482169 9606.ENSP00000221169 ENSPPYP00000020675 NYSGRC-105990539 ENSGGOP00000001414 NP_006149.2.87134 NP_006149.2.92137 XP_003823612.1.60992 XP_004046845.1.27298 XP_519665.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]