SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000482194 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000482194
Domain Number 1 Region: 571-1018
Classification Level Classification E-value
Superfamily RNI-like 1.57e-72
Family 28-residue LRR 0.0000327
Further Details:      
 
Domain Number 2 Region: 4-92
Classification Level Classification E-value
Superfamily DEATH domain 1.77e-22
Family Pyrin domain, PYD 0.0049
Further Details:      
 
Domain Number 3 Region: 171-258,287-344
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000981
Family Nucleotide and nucleoside kinases 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000482194   Gene: ENSG00000275483   Transcript: ENST00000622199
Sequence length 1037
Comment pep:known chromosome:GRCh38:CHR_HSCHR19LRC_PGF2_CTG3_1:54661303:54685299:-1 gene:ENSG00000275483 transcript:ENST00000622199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSPQLEWTLQTLLEQLNEDELKSFKSLLWAFPLEDVLQKTPWSEVEEADGKKLAEILVN
TSSENWIRNATVNILEEMNLTELCKMAKAEMMEDGQVQEIDNPELGDAEEDSELAKPGEK
EGWRNSMEKQSLVWKNTFWQGDIDNFHDDVTLRNQRFIPFLNPRTPRKLTPYTVVLHGPA
GVGKTTLAKKCMLDWTDCNLSPTLRYAFYLSCKELSRMGPCSFAELISKDWPELQDDIPS
ILAQAQRILFVVDGLDELKVPPGALIQDICGDWEKKKPVPVLLGSLLKRKMLPRAALLVT
TRPRALRDLQLLAQQPIYVRVEGFLEEDRRAYFLRHFGDEDQAMRAFELMRSNAALFQLG
SAPAVCWIVCTTLKLQMEKGEDPVPTCLTRTGLFLRFLCSRFPQGAQLRGALRTLSLLAA
QGLWAQMSVFHREDLERLGVQESDLRLFLDGDILRQDRVSKGCYSFIHLSFQQFLTALFY
ALEKEEGEDRDGHAWDIGDVQKLLSGEERLKNPDLIQVGHFLFGLANEKRAKELEATFGC
RMSPDIKQELLQCKAHLHANKPLSVTDLKEVLGCLYESQEEELAKVVVAPFKEISIHLTN
TSEVMHCSFSLKHCQDLQKLSLQVAKGVFLENYMDFELDIEFERCTYLTIPNWARQDLRS
LRLWTDFCSLFSSNSNLKFLEVKQSFLSDSSVRILCDHVTRSTCHLQKVEIKNVTPDTAY
RDFCLAFIGKKTLTHLTLAGHIEWERTMMLMLCDLLRNHKCNLQYLRLGGHCATPEQWAE
FFYVLKANQSLKHLRLSANVLLDEGAMLLYKTMTRPKHFLQMLSLENCRLTEASCKDLAA
VLVVSKKLTHLCLAKNPIGDTGVKFLCEGLSYPDCKLQTLVLQQCSITKLGCRYLSEALQ
EACSLTNLDLSINQIARGLWILCQALENPNCNLKHLRLWSCSLMPFYCQHLGSALLSNQK
LETLDLGQNHLWKSGIIKLFGVLRQRTGSLKILRLKTYETNLEIKKLLEEVKEKNPKLTI
DCNASGATAPPCCDFFC
Download sequence
Identical sequences 9606.ENSP00000329568 ENSP00000467123 ENSP00000468706 ENSP00000479459 ENSP00000480226 ENSP00000481395 ENSP00000481452 ENSP00000482194 ENSP00000482551 ENSP00000482887 ENSP00000484426 ENSP00000484808 ENSP00000464771 ENSP00000465388 ENSP00000466043 ENSP00000466171 ENSP00000466209 ENSP00000466268 ENSP00000466553 ENSP00000467009 ENSP00000467123 ENSP00000467159 ENSP00000467374 ENSP00000467853 ENSP00000468589 ENSP00000468657 ENSP00000468706 ENSP00000468742 ENSP00000474619 ENSP00000474665 NP_001120727.1.87134 NP_001120727.1.92137 XP_006723138.1.92137 XP_006723139.1.92137 XP_011524901.1.92137 gi|187937176|ref|NP_001120727.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]