SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000482488 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000482488
Domain Number 1 Region: 196-360
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-38
Family Dual specificity phosphatase-like 0.0000142
Further Details:      
 
Domain Number 2 Region: 372-501
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.6e-37
Family PLC-like (P variant) 0.001
Further Details:      
 
Domain Number 3 Region: 54-186
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000785
Family Voltage-gated potassium channels 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000482488   Gene: ENSG00000274391   Transcript: ENST00000427445
Sequence length 513
Comment pep:known chromosome:GRCh38:21:10521575:10605716:1 gene:ENSG00000274391 transcript:ENST00000427445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNESPDPTDLAGVIIELGPNDSPQTSEFKGATEEAPAKESSKIKKIVHSIVSSFAFGLFG
VFLVLLDVTLILADLIFTDSKLYIPLEYRSISLAIALFFLMDVLLRVFVERRQQYFSDLF
NILDTAIIVILLLVDVVYIFFDIKLLRNIPRWTHLLRLLRLIILLRIFHLFHQKRQLEKL
IRRRVSENKRRYTRDGFDLDLTYVTERIIAMSFPSSGRQSFYRNPIKEVVRFLDKKHRNH
YRVYNLCSERAYDPKHFHNRVVRIMIDDHNVPTLHQMVVFTKEVNEWMAQDLENIVAIHC
KGGTDRTGTMVCAFLIASEICSTAKESLYYFGERRTDKTHSEKFQGVKTPSQKRYVAYFA
QVKHLYNWNLPPRRILFIKHFIIYSIPRYVRDLKIQIEMEKKVVFSTISLGKCSVLDNIT
TDKILIDVFDGLPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYLPKNELDNL
HKQKARRIYPSDFAVEILFGEKMTSSDVVAGSD
Download sequence
Identical sequences ENSP00000344441 ENSP00000482488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]