SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000483160 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000483160
Domain Number 1 Region: 399-909
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.32e-71
Family Tandem AAA-ATPase domain 0.027
Further Details:      
 
Weak hits

Sequence:  ENSP00000483160
Domain Number - Region: 247-281
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00157
Family Double-stranded RNA-binding domain (dsRBD) 0.015
Further Details:      
 
Domain Number - Region: 39-87
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0126
Family Double-stranded RNA-binding domain (dsRBD) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000483160   Gene: ENSG00000132153   Transcript: ENST00000619982
Sequence length 1155
Comment pep:known chromosome:GRCh38:3:47819227:47850195:1 gene:ENSG00000132153 transcript:ENST00000619982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASRDLLKEFPQPKNLLNSVIGRALGISHAKDKLVYVHTNGPKKKKVTLHIKWPKSVEV
EGYGSKKIDAERQAAAAACQLFKGWGLLGPRNELFDAAKYRVLADRFGSPADSWWRPEPT
MPPTSWRQLNPESIRPGGPGGLSRSLGREEEEDEEEELEEGTIDVTDFLSMTQQDSHAPL
RDSRGSSFEMTDDDSAIRALTQFPLPKNLLAKVIQIATSSSTAKNLMQFHTVGTKTKLST
LTLLWPCPMTFVAKGRRKAEAENKAAALACKKLKSLGLVDRNNEPLTHAMYNLASLRELG
ETQRRPCTIQVPEPILRKIETFLNHYPVESSWIAPELRLQSDDILPLGKDSGPLSDPITG
KPYVPLLEAEEVRLSQSLLELWRRRGPVWQEAPQLPVDPHRDTILNAIEQHPVVVISGDT
GCGKTTRIPQLLLERYVTEGRGARCNVIITQPRRISAVSVAQRVSHELGPSLRRNVGFQV
RLESKPPSRGGALLFCTVGILLRKLQSNPSLEGVSHVIVDEVHERDVNTDFLLILLKGLQ
RLNPALRLVLMSATGDNERFSRYFGGCPVIKVPGFMYPVKEHYLEDILAKLGKHQYLHRH
RHHESEDECALDLDLVTDLVLHIDARGEPGGILCFLPGWQEIKGVQQRLQEALGMHESKY
LILPVHSNIPMMDQKAIFQQPPVGVRKIVLATNIAETSITINDIVHVVDSGLHKEERYDL
KTKVSCLETVWVSRANVIQRRGRAGRCQSGFAYHLFPRSRLEKMVPFQVPEILRTPLENL
VLQAKIHMPEKTAVEFLSKAVDSPNIKAVDEAVILLQEIGVLDQREYLTTLGQRLAHIST
DPRLAKAIVLAAIFRCLHPLLVVVSCLTRDPFSSSLQNRAEVDKVKALLSHDSGSDHLAF
VRAVAGWEEVLRWQDRSSRENYLEENLLYAPSLRFIHGLIKQFSENIYEAFLVGKPSDCT
LASAQCNEYSEEEELVKGVLMAGLYPNLIQVRQGKVTRQGKFKPNSVTYRTKSGNILLHK
STINREATRLRSRWLTYFMAVKSNGSVFVRDSSQVHPLAVLLLTDGDVHIRDDGRRATIS
LSDSDLLRLEGDSRTVRLLKELRRALGRMVERSLRSELAALPPSVQEEHGQLLALLAELL
RGPCGSFDVRKTADD
Download sequence
Identical sequences K7DT13
gi|20336290|ref|NP_055781.2| NP_055781.2.87134 NP_055781.2.92137 XP_016796499.1.37143 XP_016861406.1.92137 ENSP00000392601 ENSP00000483160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]