SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000484179 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000484179
Domain Number - Region: 171-227
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0212
Family N-terminal domain of adrenodoxin reductase-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000484179   Gene: ENSG00000125629   Transcript: ENST00000614681
Sequence length 238
Comment pep:known chromosome:GRCh38:2:118096418:118108853:1 gene:ENSG00000125629 transcript:ENST00000614681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPP
DVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH
ASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQY
TSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAENLIRNEEGKKYLLYRKAR
Download sequence
Identical sequences A0A0C4DGZ4 A0A2J8M246
ENSP00000484179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]