SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000484852 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000484852
Domain Number 1 Region: 523-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-24
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 2 Region: 411-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-24
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 244-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.41e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 68-116
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.72e-23
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 5 Region: 299-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 6 Region: 355-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 467-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 8 Region: 579-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 9 Region: 188-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-16
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 10 Region: 643-668
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000156
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000484852   Gene: ENSG00000167637   Transcript: ENST00000618787
Sequence length 679
Comment pep:known chromosome:GRCh38:19:43827292:43852017:1 gene:ENSG00000167637 transcript:ENST00000618787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESRSVAQAGVQWCDLGSLQAPPPGFTLFSCLSLLSSWDYSSGFSGFCASPIEESHGALI
SSCNSRTMTDGLVTFRDVAIDFSQEEWECLDPAQRDLYVDVMLENYSNLVSLDLESKTYE
TKKIFSENDIFEINFSQWEMKDKSKTLGLEASIFRNNWKCKSIFEGLKGHQEGYFSQMII
SYEKIPSYRKSKSLTPHQRIHNTEKSYVCKECGKACSHGSKLVQHERTHTAEKHFECKEC
GKNYLSAYQLNVHQRFHTGEKPYECKECGKTFSWGSSLVKHERIHTGEKPYECKECGKAF
SRGYHLTQHQKIHTGVKSYKCKECGKAFFWGSSLAKHEIIHTGEKPYKCKECGKAFSRGY
QLTQHQKIHTGKKPYECKICGKAFCWGYQLTRHQIFHTGEKPYECKECGKAFNCGSSLIQ
HERIHTGEKPYECKECGKAFSRGYHLSQHQKIHTGEKPFECKECGKAFSWGSSLVKHERV
HTGEKSHECKECGKTFCSGYQLTRHQVFHTGEKPYECKECGKAFNCGSSLVQHERIHTGE
KPYECKECGKAFSRGYHLTQHQKIHTGEKPFKCKECGKAFSWGSSLVKHERVHTNEKSYE
CKDCGKAFGSGYQLSVHQRFHTGEKLYQRKEFGKTFTCGSKLVHERTHSNDKPYKYNECG
EAFLWTTYSNEKIDTDETL
Download sequence
Identical sequences Q8N7M2
NP_862828.1.87134 NP_862828.1.92137 XP_016882117.1.92137 XP_016882118.1.92137 XP_016882119.1.92137 XP_016882120.1.92137 ENSP00000327314 ENSP00000484852 ENSP00000327314 ENSP00000327314 gi|149588643|ref|NP_862828.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]