SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000484926 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000484926
Domain Number 1 Region: 367-461
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 1.83e-36
Family Small-conductance potassium channel 0.00000507
Further Details:      
 
Domain Number 2 Region: 236-409
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.75e-26
Family Voltage-gated potassium channels 0.004
Further Details:      
 
Weak hits

Sequence:  ENSP00000484926
Domain Number - Region: 462-525
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.0235
Family Outer membrane efflux proteins (OEP) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000484926   Gene: ENSG00000105642   Transcript: ENST00000615435
Sequence length 543
Comment pep:known chromosome:GRCh38:19:17973869:17998445:1 gene:ENSG00000105642 transcript:ENST00000615435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSHSYNGSVGRPLGSGPGALGRDPPDPEAGHPPQPPHSPGLQVVVAKSEPARPSPGSPR
GQPQDQDDDEDDEEDEAGRQRASGKPSNVGHRLGHRRALFEKRKRLSDYALIFGMFGIVV
MVTETELSWGVYTKESLYSFALKCLISLSTAILLGLVVLYHAREIQLFMVDNGADDWRIA
MTCERVFLISLELAVCAIHPVPGHYRFTWTARLAFTYAPSVAEADVDVLLSIPMFLRLYL
LGRVMLLHSKIFTDASSRSIGALNKITFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWT
VRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTAL
VVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQARV
RKHQRKFLQAIHQVQRLRSVKIEQGKLNDQANTLTDLAKTQTVMYDLVSELHAQHEELEA
RLATLESRLDALGASLQALPGLIAQAIRPPPPPLPPRPGPGPQDQAARSSPCRWTPVAPS
DCG
Download sequence
Identical sequences A0A087X2E7
ENSP00000484926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]