SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000216450 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000216450
Domain Number 1 Region: 80-170
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000000251
Family 28-residue LRR 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000216450   Gene: ENSG00000100565   Transcript: ENST00000216450
Sequence length 200
Comment pep:known chromosome:GRCh37:14:77292715:77336645:1 gene:ENSG00000100565 transcript:ENST00000216450 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MHIQFPSKPTLPRACWEGRITAGSPGMPPDEIEIEPVRQSSDKMLYCEAESPPTVEKVKP
ARENSETDLEIEDDEKFFTTGQKELYLEACKLMGVVPVSYFIRNMEESYVNLNHHGLGPR
GTKAIAIALVSNMAVTKLELEDNCIMEEGVLSLVEMLQENYYLQEMEMTSRKTPQHCSAK
PCRPITKLKSWISVTTNSLM
Download sequence
Identical sequences H7BXD0
ENSP00000216450 ENSP00000216450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]