SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000216479 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000216479
Domain Number 1 Region: 20-161
Classification Level Classification E-value
Superfamily Activator of Hsp90 ATPase, Aha1 6.15e-44
Family Activator of Hsp90 ATPase, Aha1 0.0013
Further Details:      
 
Domain Number 2 Region: 205-334
Classification Level Classification E-value
Superfamily Bet v1-like 1.1e-28
Family AHSA1 domain 0.000000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000216479   Gene: ENSG00000100591   Transcript: ENST00000216479
Sequence length 338
Comment pep:known chromosome:GRCh37:14:77924373:77935817:1 gene:ENSG00000100591 transcript:ENST00000216479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKWGEGDPRWIVEERADATNVNNWHWTERDASNWSTDKLKTLFLAVQVQNEEGKCEVTE
VSKLDGEASINNRKGKLIFFYEWSVKLNWTGTSKSGVQYKGHVEIPNLSDENSVDEVEIS
VSLAKDEPDTNLVALMKEEGVKLLREAMGIYISTLKTEFTQGMILPTMNGESVDPVGQPA
LKTEERKAKPAPSKTQARPVGVKIPTCKITLKETFLTSPEELYRVFTTQELVQAFTHAPA
TLEADRGGKFHMVDGNVSGEFTDLVPEKHIVMKWRFKSWPEGHFATITLTFIDKNGETEL
CMEGRGIPAPEEERTRQGWQRYYFEGIKQTFGYGARLF
Download sequence
Identical sequences G3QXU4 O95433
9606.ENSP00000216479 ENSP00000216479 ENSGGOP00000007658 gi|6912280|ref|NP_036243.1| GO.35431 HR46 NP_036243.1.87134 NP_036243.1.92137 XP_018865111.1.27298 ENSGGOP00000007658 ENSP00000216479 ENSP00000216479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]