SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000217162 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000217162
Domain Number 1 Region: 349-423
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000119
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000217162   Gene: ENSG00000101190   Transcript: ENST00000217162
Sequence length 483
Comment pep:known chromosome:GRCh37:20:61476490:61493115:-1 gene:ENSG00000101190 transcript:ENST00000217162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEVEYTQLQHILCSHMEAAADGELETRLNSALLAAAGPGAGAGGFAAGGQGGAAPVYPV
LCPSALAADAPCLGHIDFQELRMMLLSEAGAAEKTSGGGDGARARADGAAKEGAGAAAAA
AGPDGAPEARAKPAVRVRLEDRFNSIPAEPPPAPRGPEPPEPGGALNNLVTLIRHPSELM
NVPLQQQNKCTALVKNKTAATTTALQFTYPLFTTNACSTSGNSNLSQTQSSSNSCSVLEA
AKHQDIGLPRAFSFCYQQEIESTKQTLGSRNKVLPEQVWIKVGEAALCKQALKRNRSRMR
QLDTNVERRALGEIQNVGEGATATQGAWQSSESSQANLGEQAQSGPQGGRSQRRERHNRM
ERDRRRRIRICCDELNLLVPFCNAETDKATTLQWTTAFLKYIQERHGDSLKKVLSTNSRY
VMLWTCFLKMKSAVDGKNPQHAYRTANHKWLCLHEARSFAFEVSIWAHFQLFRVRIPEGF
LSI
Download sequence
Identical sequences F8W9A4
ENSP00000217162 ENSP00000217162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]