SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000221462 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000221462
Domain Number 1 Region: 52-426
Classification Level Classification E-value
Superfamily RNI-like 2.75e-65
Family 28-residue LRR 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000221462   Gene: ENSG00000104866   Transcript: ENST00000221462
Sequence length 691
Comment pep:known chromosome:GRCh37:19:45596220:45650543:1 gene:ENSG00000104866 transcript:ENST00000221462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIAPQEAPPVPGADGDIEEAPAEAGSPSPASPPADGRLKAAAKRVTFPSDEDIVSGAVE
PKDPWRHAQNVTVDEVIGAYKQACQKLNCRQIPKLLRQLQEFTDLGHRLDCLDLKGEKLD
YKTCEALEEVFKRLQFKVVDLEQTNLDEDGASALFDMIEYYESATHLNISFNKHIGTRGW
QAAAHMMRKTSCLQYLDARNTPLLDHSAPFVARALRIRSSLAVLHLENASLSGRPLMLLA
TALKMNMNLRELYLADNKLNGLQDSAQLGNLLKFNCSLQILDLRNNHVLDSGLAYICEGL
KEQRKGLVTLVLWNNQLTHTGMAFLGMTLPHTQSLETLNLGHNPIGNEGVRHLKNGLISN
RSVLRLGLASTKLTCEGAVAVAEFIAESPRLLRLDLRENEIKTGGLMALSLALKVNHSLL
RLDLDREPKKEAVKSFIETQKALLAEIQNGCKRNLVLAREREEKEQPPQLSASMPETTAT
EPQPDDEPAAGVQNGAPSPAPSPDSDSDSDSDGEEEEEEEGERDETPCPALVPPTDSLGP
GDRSPPGSPSTPTEQRISVSSPGRGHKVFVVTRVESPPERAEPPASPTPPSPPPPPSPPA
SPSLPPAGAIDTRDTGSSEPQPPPEPPRSGPPLPNGLKPEFALALPPEPPPGPEVKGGSC
GLEHELSCSKNEKELEELLLEASQESGQETL
Download sequence
Identical sequences O75864
gi|338797736|ref|NP_061994.1| NP_061994.1.87134 NP_061994.1.92137 XP_003817583.1.60992 ENSP00000221462 ENSP00000390861 ENSP00000221462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]