SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000221943 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000221943
Domain Number 1 Region: 134-214
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000159
Family Cyclin A/CDK2-associated p19, Skp2 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000221943   Gene: ENSG00000105341   Transcript: ENST00000221943
Sequence length 257
Comment pep:known chromosome:GRCh37:19:41937224:41945810:-1 gene:ENSG00000105341 transcript:ENST00000221943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPWASLRLVAPMWNGRIRGIHRLGAAVAPEGNQKKKRTILQFLTNYFYDVEALRDYLL
QREMYKVHEKNRSYTWLEKQHGPYGAGAFFILKQGGAVKFRDKEWIRPDKYGHFSQEFWN
FCEVPVEAVDAGDCDINYEGLDNLLRLKELQSLSLQRCCHVDDWCLSRLYPLADSLQELS
LAGCPRISERGLACLHHLQNLRRLDISDLPAVSNPGLTQILVEEMLPNCEVVGVDWAEGL
KSGPEEQPRDTASPVPA
Download sequence
Identical sequences A0A024R0K4 Q9NW81
ENSP00000221943 9606.ENSP00000221943 gi|268832172|ref|NP_060505.2| ENSP00000221943 ENSP00000477178 NP_060505.2.87134 NP_060505.2.92137 HR6619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]