SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000228644 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000228644
Domain Number 1 Region: 83-160
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.32e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0000812
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000228644   Gene: ENSG00000111049   Transcript: ENST00000228644
Sequence length 255
Comment pep:known chromosome:GRCh37:12:81110691:81113452:1 gene:ENSG00000111049 transcript:ENST00000228644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVMDGCQFSPSEYFYDGSCIPSPEGEFGDEFVPRVAAFGAHKAELQGSDEDEHVRAPTG
HHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPK
VEILRNAIRYIESLQELLREQVENYYSLPGQSCSEPTSPTSNCSDGMPECNSPVWSRKSS
TFDSIYCPDVSNVYATDKNSLSSLDCLSNIVDRITSSEQPGLPLQDLASLSPVASTDSQP
ATPGASSSRLIYHVL
Download sequence
Identical sequences H2Q6J3 P13349
ENSP00000228644 HR4467 ENSPTRP00000008937 gi|156104906|ref|NP_005584.2| ENSP00000228644 ENSPTRP00000008937 9598.ENSPTRP00000008937 9606.ENSP00000228644 ENSP00000228644 NP_005584.2.87134 NP_005584.2.92137 XP_522481.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]