SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000229268 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000229268
Domain Number 1 Region: 322-492,532-617,660-688,749-856
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.89e-86
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00056
Further Details:      
 
Domain Number 2 Region: 175-283
Classification Level Classification E-value
Superfamily RING/U-box 2.24e-37
Family Zf-UBP 0.000000665
Further Details:      
 
Domain Number 3 Region: 710-767
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000108
Family UBA domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000229268   Gene: ENSG00000111667   Transcript: ENST00000229268
Sequence length 858
Comment pep:known chromosome:GRCh37:12:6961292:6975793:1 gene:ENSG00000111667 transcript:ENST00000229268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFGKQYVER
HFNKTGQRVYLHLRRTRRPKEEDPATGTGDPPRKKPTRLAIGVEGGFDLSEEKFELDEDV
KIVILPDYLEIARDGLGGLPDIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHA
FSLKQLDNPARIPPCGWKCSKCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHYRET
GYPLAVKLGTITPDGADVYSYDEDDMVLDPSLAEHLSHFGIDMLKMQKTDKTMTELEIDM
NQRIGEWELIQESGVPLKPLFGPGYTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVDKLEK
IFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPVPESGDGERVPEQKEVQDGIAPRMFKAL
IGKGHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPNEVFRFLVEEKIKCLATEKVKYT
QRVDYIMQLPVPMDAALNKEELLEYEEKKRQAEEEKMALPELVRAQVPFSSCLEAYGAPE
QVDDFWSTALQAKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDIS
QLRGTGLQPGEEELPDIAPPLVTPDEPKGSLGFYGNEDEDSFCSPHFSSPTSPMLDESVI
IQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLILPGSSGPGSTSAAA
DPPPEDCVTTIVSMGFSRDQALKALRATNNSLERAVDWIFSHIDDLDAEAAMDISEGRSA
ADSISESVPVGPKVRDGPGKYQLFAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCAS
EKPPKDLGYIYFYQRVAS
Download sequence
Identical sequences A0A140VJZ1 G3QJI4 K7B7B4 P45974
ENSGGOP00000002580 gi|148727331|ref|NP_001092006.1| ENSP00000229268 ENSP00000229268 ENSGGOP00000002580 ENSP00000229268 ENSP00000472079 NP_001092006.1.87134 NP_001092006.1.92137 XP_003820323.1.60992 XP_004052641.1.27298 XP_016778348.1.37143 9606.ENSP00000229268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]