SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000230323 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000230323
Domain Number 1 Region: 229-298
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000366
Family HLH, helix-loop-helix DNA-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSP00000230323
Domain Number - Region: 288-377
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 0.0387
Family NADH oxidase/flavin reductase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000230323   Gene: ENSG00000112561   Transcript: ENST00000230323
Sequence length 476
Comment pep:known chromosome:GRCh37:6:41651716:41702798:-1 gene:ENSG00000112561 transcript:ENST00000230323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRIGLRMQLMREQAQQEEQRERMQQQAVMHYMQQQQQQQQQQLGGPPTPAINTPVHFQ
SPPPVPGEVLKVQSYLENPTSYHLQQSQHQKVREYLSETYGNKFAAHISPAQGSPKPPPA
ASPGVRAGHVLSSSAGNSAPNSPMAMLHIGSNPERELDDVIDNIMRLDDVLGYINPEMQM
PNTLPLSSSHLNVYSSDPQVTASLVGVTSSSCPADLTQKRELTDAESRALAKERQKKDNH
NLIERRRRFNINDRIKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELEN
HSRRLEMTNKQLWLRIQELEMQARVHGLPTTSPSGMNMAELAQQVVKQELPSEEGPGEAL
MLGAEVPDPEPLPALPPQAPLPLPTQPPSPFHHLDFSHSLSFGGREDEGPPGYPEPLAPG
HGSPFPSLSKKDLDLMLLDDSLLPLASDPLLSTMSPEASKASSRRSSFSMEEGDVL
Download sequence
Identical sequences A0A024RCY3 P19484
9606.ENSP00000230323 ENSP00000230323 ENSP00000362124 ENSP00000384203 NP_001258873.1.87134 NP_001258873.1.92137 NP_001258874.1.87134 NP_001258874.1.92137 NP_009093.1.87134 NP_009093.1.92137 XP_005249468.1.92137 XP_005249469.1.92137 XP_006715275.1.92137 XP_006715276.1.92137 XP_011513217.1.92137 XP_011513218.1.92137 gi|24307933|ref|NP_009093.1| gi|268607700|ref|NP_001161299.1| ENSP00000230323 ENSP00000362124 ENSP00000384203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]