SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000235347 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000235347
Domain Number 1 Region: 158-407
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000000186
Family Cyclin A/CDK2-associated p19, Skp2 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000235347   Gene: ENSG00000187545   Transcript: ENST00000235347
Sequence length 474
Comment pep:known chromosome:GRCh37:1:12952727:12958101:-1 gene:ENSG00000187545 transcript:ENST00000235347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLQAPSRLLELAGQSLLRNQFLTIFTLDELPREVFPLMFMEAFSMRRFEALKLMVQAWP
FLSLPLGSLMKTLHLETLQAVLRGLDTLVAQKVRPRRWKLQVLDLRDVDENFWTIWSGAR
VLSCSPEAMSKRQTVEDCPRMGEHQPLKVFIDLCLKESTLDECLSYLFGWIHYRRGLVHL
CCSKVQNYSMPTSSFRNLLERIYPDSIQELEVWKKCSLNKTGKFAPYLSQMSNLRELFLA
FGYERELYVSVQWPCIPDLDSPFLCLYYPQMLYIKKISNIKEHLEHLLRYLKNPLGAFIF
SDAYLTDRDMECLSQYPSLSQLKELRLIHILMWTTHLEPLGVLLEKVAATLKTLVLKDCR
IQDPQLRVLLPALSHCSQLTTFNFHGNETSMNALKDLLRHTGGLSKLGLELYPAPLESLD
YKGHVNWEILTPIRAELMRTLREVRQPKRIFFGPVPCPNCGSWPSEKVDFHLCS
Download sequence
Identical sequences gi|194018546|ref|NP_001034450.2| ENSP00000235347 9606.ENSP00000235347 ENSP00000235347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]