SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000244869 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000244869
Domain Number 1 Region: 65-108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000026
Family EGF-type module 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000244869   Gene: ENSG00000124882   Transcript: ENST00000244869
Sequence length 169
Comment pep:known chromosome:GRCh37:4:75230860:75254468:1 gene:ENSG00000124882 transcript:ENST00000244869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAGRRMEMLCAGRVPALLLCLGFHLLQAVLSTTVIPSCIPGESSDNCTALVQTEDNPRV
AQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYVA
LTVILIILFLITVVGSTYYFCRWYRNRKSKEPKKEYERVTSGDPELPQV
Download sequence
Identical sequences O14944
9606.ENSP00000244869 ENSP00000244869 ENSP00000244869 gi|4557567|ref|NP_001423.1| ENSP00000244869 NP_001423.1.87134 NP_001423.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]