SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000245812 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000245812
Domain Number 1 Region: 31-204
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.51e-21
Family AlkB-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000245812   Gene: ENSG00000125652   Transcript: ENST00000245812
Sequence length 221
Comment pep:known chromosome:GRCh37:19:6372444:6375040:1 gene:ENSG00000125652 transcript:ENST00000245812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTGLLALRTLPGPSWVRGSGPSVLSRLQDAAVVRPGFLSTAEEETLSRELEPELRRRR
YEYDHWDAAIHGFRETEKSRWSEASRAILQRVQAAAFGPGQTLLSSVHVLDLEARGYIKP
HVDSIKFCGATIAGLSLLSPSVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEIL
RDEESFFGERRIPRGRRISVICRSLPEGMGPGESGQPPPAC
Download sequence
Identical sequences H2QF45 Q9BT30
ENSPTRP00000017623 ENSPTRP00000017623 NP_115682.1.87134 NP_115682.1.92137 XP_001149298.1.37143 XP_003819380.1.60992 gi|14150066|ref|NP_115682.1| ENSP00000245812 9598.ENSPTRP00000017623 9606.ENSP00000245812 ENSP00000245812 ENSP00000245812 HR2500 HR5599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]