SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000246163 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000246163
Domain Number 1 Region: 17-58
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000107
Family HLH, helix-loop-helix DNA-binding domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000246163   Gene: ENSG00000125952   Transcript: ENST00000246163
Sequence length 96
Comment pep:known chromosome:GRCh37:14:65550462:65569227:-1 gene:ENSG00000125952 transcript:ENST00000246163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKLYF
LFWKLCTPVLHRQSLMQKCHTFISSYQVHKKKECKI
Download sequence
Identical sequences ENSP00000246163 NP_660089.1.87134 NP_660089.1.92137 gi|21704267|ref|NP_660089.1| ENSP00000246163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]