SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000248139 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000248139
Domain Number 1 Region: 10-189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.86e-44
Family G proteins 0.0000221
Further Details:      
 
Domain Number 2 Region: 189-228
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000785
Family SOCS box-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000248139   Gene: ENSG00000197562   Transcript: ENST00000248139
Sequence length 281
Comment pep:known chromosome:GRCh37:16:640089:679272:1 gene:ENSG00000197562 transcript:ENST00000248139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSQGSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGAAESPYAYSNGIDYKTTTILLDG
RRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPGVP
RILVGNRLHLAFKRQVPTEQARAYAEKNCMTFFEVSPLCNFNVIESFTELSRIVLMRHGM
EKIWRPNRVFSLQDLCCRAIVSCTPVHLIDKLPLPVTIKSHLKSFSMANGMNAVMMHGRS
YSLASGAGGGGSKGNSLKRSKSIRPPQSPPQNCSRSNCKIS
Download sequence
Identical sequences A0A0D9RJR9 A0A2I2YU74 A0A2K5D1U1 A0A2K5MWX2 A0A2K5WP85 A0A2K6CPE2 A9L8V2 H2NPK4 H2QA75 I2CVA7 Q96S21
ENSPPYP00000007829 NP_001166134.1.87134 NP_001166134.1.92137 NP_001166135.1.87134 NP_001166135.1.92137 NP_001166136.1.87134 NP_001166136.1.92137 NP_066991.3.87134 NP_066991.3.92137 XP_002825965.1.23681 XP_005590829.1.63531 XP_007978449.1.81039 XP_011746817.1.29376 XP_011890808.1.92194 XP_016784511.1.37143 XP_018867316.1.27298 XP_018867317.1.27298 XP_021530756.1.9421 ENSPANP00000013464 9598.ENSPTRP00000012882 9600.ENSPPYP00000007829 9606.ENSP00000248139 ENSPTRP00000012882 ENSP00000248139 ENSP00000438382 ENSP00000438492 ENSP00000445050 gi|289547660|ref|NP_066991.3| gi|289547662|ref|NP_001166134.1| gi|289547665|ref|NP_001166135.1| gi|289547667|ref|NP_001166136.1| ENSP00000248139 ENSPTRP00000012882 ENSP00000248139 ENSP00000438382 ENSP00000438492 ENSP00000445050 ENSPPYP00000007829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]