SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000249700 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000249700
Domain Number 1 Region: 184-346
Classification Level Classification E-value
Superfamily RNI-like 1.7e-45
Family 28-residue LRR 0.00000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000249700   Gene: ENSG00000128872   Transcript: ENST00000249700
Sequence length 351
Comment pep:known chromosome:GRCh37:15:52043758:52108565:1 gene:ENSG00000128872 transcript:ENST00000249700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPFQKELEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESAMLPAGFRQKDQTQKAA
TGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPIETRKEEKVTLDPELE
EALASASDTELYDLAAVLGVHNLLNNPKFDEETANNKGGKGPVRNVVKGEKVKPVFEEPP
NPTNVEISLQQMKANDPSLQEVNLNNIKNIPIPTLREFAKALETNTHVKKFSLAATRSND
PVAIAFADMLKVNKTLTSLNIESNFITGTGILALVEALKENDTLTEIKIDNQRQQLGTAV
EMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEADRR
Download sequence
Identical sequences G3RI10 Q9NZR1
gi|7657647|ref|NP_055363.1| ENSP00000249700 ENSP00000249700 NP_055363.1.87134 NP_055363.1.92137 XP_004056233.1.27298 ENSP00000249700 9606.ENSP00000249700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]