SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000257468 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000257468
Domain Number 1 Region: 24-107
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.41e-24
Family Ubiquitin-related 0.0000285
Further Details:      
 
Domain Number 2 Region: 508-557
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000221
Family UBA domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSP00000257468
Domain Number - Region: 206-256
Classification Level Classification E-value
Superfamily ARM repeat 0.000196
Family Mo25 protein 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000257468   Gene: ENSG00000135018   Transcript: ENST00000257468
Sequence length 561
Comment pep:known chromosome:GRCh37:9:86276344:86322849:-1 gene:ENSG00000135018 transcript:ENST00000257468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESGESGGPPGSQDSAAGAEGAGAPAAAASAEPKIMKVTVKTPKEKEEFAVPENSSVQQ
FKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRPQDHSAQQT
NTAGSNVTTSSTPNSNSTSGSATSNPFGLGGLGGLAGLSSLGLNTTNFSELQSQMQRQLL
SNPEMMVQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHMLNNPDIMRQTLE
LARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMLSAAQEQFGGNPFASLV
SNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTASTVGGTTGSTASGTSGQSTTA
PNLVPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLAAQMQNP
DTLSAMSNPRAMQALLQIQQGLQTLATEAPGLIPGFTPGLGALGSTGGSSGTNGSNATPS
ENTSPTAGTTEPGHQQFIQQMLQALAGVNPQLQNPEVRFQQQLEQLSAMGFLNREANLQA
LIATGGDINAAIERLLGSQPS
Download sequence
Identical sequences A0A024R258
gi|16753205|ref|NP_444295.1| ENSP00000257468 NP_444295.1.87134 NP_444295.1.92137 ENSP00000257468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]