SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000260010 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000260010
Domain Number 1 Region: 637-782
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.31e-45
Family Toll/Interleukin receptor TIR domain 0.0000000465
Further Details:      
 
Domain Number 2 Region: 45-166,354-554
Classification Level Classification E-value
Superfamily RNI-like 1.73e-35
Family Cyclin A/CDK2-associated p19, Skp2 0.032
Further Details:      
 
Domain Number 3 Region: 143-235
Classification Level Classification E-value
Superfamily L domain-like 0.00000102
Family Internalin LRR domain 0.049
Further Details:      
 
Weak hits

Sequence:  ENSP00000260010
Domain Number - Region: 226-402
Classification Level Classification E-value
Superfamily L domain-like 0.000146
Family Internalin LRR domain 0.077
Further Details:      
 
Domain Number - Region: 592-653
Classification Level Classification E-value
Superfamily Fumarate reductase respiratory complex transmembrane subunits 0.000161
Family Fumarate reductase respiratory complex cytochrome b subunit, FrdC 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000260010   Gene: ENSG00000137462   Transcript: ENST00000260010
Sequence length 784
Comment pep:known chromosome:GRCh37:4:154622652:154626851:1 gene:ENSG00000137462 transcript:ENST00000260010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLS
NNRITYISNSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWF
KPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELE
IDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVECLELRDTDLDTFHFS
ELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDN
DRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFLVPCLLSQHLK
SLEYLDLSENLMVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNIDI
SKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLNLPQLK
ELYISRNKLMTLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTLKTLEAGGNNFICSCE
FLSFTQEQQALAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFL
LILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMV
QELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFS
HFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRA
AIKS
Download sequence
Identical sequences A0A0S2Z4S4 O60603
gi|19718734|ref|NP_003255.2| ENSP00000260010 NP_001305716.1.87134 NP_001305716.1.92137 NP_001305718.1.87134 NP_001305718.1.92137 NP_001305719.1.87134 NP_001305719.1.92137 NP_001305720.1.87134 NP_001305720.1.92137 NP_001305722.1.87134 NP_001305722.1.92137 NP_001305724.1.87134 NP_001305724.1.92137 NP_001305725.1.87134 NP_001305725.1.92137 NP_003255.2.87134 NP_003255.2.92137 XP_011530517.1.92137 XP_011530518.1.92137 XP_016864062.1.92137 XP_016864063.1.92137 XP_016864064.1.92137 XP_016864065.1.92137 ENSP00000260010 HosaA.17234.a ENSP00000260010 9606.ENSP00000260010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]