SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000262302 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000262302
Domain Number 1 Region: 10-243
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.42e-56
Family Nitrogenase iron protein-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000262302   Gene: ENSG00000095906   Transcript: ENST00000262302
Sequence length 271
Comment pep:known chromosome:GRCh37:16:1832902:1839192:1 gene:ENSG00000095906 transcript:ENST00000262302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAAEPGNLAGVRHIILVLSGKGGVGKSTISTELALALRHAGKKVGILDVDLCGPSIPR
MLGAQGRAVHQCDRGWAPVFLDREQSISLMSVGFLLEKPDEAVVWRGPKKNALIKQFVSD
VAWGELDYLVVDTPPGTSDEHMATIEALRPYQPLGALVVTTPQAVSVGDVRRELTFCRKT
GLRVMGIVENMSGFTCPHCTECTSVFSRGGGEELAQLAGVPFLGSVPLDPALMRTLEEGH
DFIQEFPGSPAFAALTSIAQKILDATPACLP
Download sequence
Identical sequences Q9Y5Y2
gi|6912540|ref|NP_036357.1| HR5101 hss001000162.1 9606.ENSP00000262302 Hs6912540___KOG3022 NP_036357.1.87134 NP_036357.1.92137 ENSP00000262302 ENSP00000262302 ENSP00000262302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]