SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000263087 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000263087
Domain Number 1 Region: 366-678
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.01e-54
Family Integrin alpha N-terminal domain 0.0000521
Further Details:      
 
Domain Number 2 Region: 195-388
Classification Level Classification E-value
Superfamily vWA-like 2.67e-42
Family Integrin A (or I) domain 0.0000354
Further Details:      
 
Domain Number 3 Region: 828-960
Classification Level Classification E-value
Superfamily Integrin domains 1.67e-28
Family Integrin domains 0.0053
Further Details:      
 
Domain Number 4 Region: 678-824
Classification Level Classification E-value
Superfamily Integrin domains 0.0000012
Family Integrin domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000263087   Gene: ENSG00000083457   Transcript: ENST00000263087
Sequence length 1179
Comment pep:known chromosome:GRCh37:17:3617922:3704537:-1 gene:ENSG00000083457 transcript:ENST00000263087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLFHTLLCIASLALLAAFNVDVARPWLTPKGGAPFVLSSLLHQDPSTNQTWLLVTSPRT
KRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSS
ELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDVNTARQRRAL
EKEEEEDKEEEEDEEEEEAGTEIAIILDGSGSIDPPDFQRAKDFISNMMRNFYEKCFECN
FALVQYGGVIQTEFDLRDSQDVMASLARVQNITQVGSVTKTASAMQHVLDSIFTSSHGSR
RKASKVMVVLTDGGIFEDPLNLTTVINSPKMQGVERFAIGVGEEFKSARTARELNLIASD
PDETHAFKVTNYMALDGLLSKLRYNIISMEGTVGDALHYQLAQIGFSAQILDERQVLLGA
VGAFDWSGGALLYDTRSRRGRFLNQTAAAAADAEAAQYSYLGYAVAVLHKTCSLSYIAGA
PRYKHHGAVFELQKEGREASFLPVLEGEQMGSYFGSELCPVDIDMDGSTDFLLVAAPFYH
VHGEEGRVYVYRLSEQDGSFSLARILSGHPGFTNARFGFAMAAMGDLSQDKLTDVAIGAP
LEGFGADDGASFGSVYIYNGHWDGLSASPSQRIRASTVAPGLQYFGMSMAGGFDISGDGL
ADITVGTLGQAVVFRSRPVVRLKVSMAFTPSALPIGFNGVVNVRLCFEISSVTTASESGL
REALLNFTLDVDVGKQRRRLQCSDVRSCLGCLREWSSGSQLCEDLLLMPTEGELCEEDCF
SNASVKVSYQLQTPEGQTDHPQPILDRYTEPFAIFQLPYEKACKNKLFCVAELQLATTVS
QQELVVGLTKELTLNINLTNSGEDSYMTSMALNYPRNLQLKRMQKPPSPNIQCDDPQPVA
SVLIMNCRIGHPVLKRSSAHVSVVWQLEENAFPNRTADITVTVTNSNERRSLANETHTLQ
FRHGFVAVLSKPSIMYVNTGQGLSHHKEFLFHVHGENLFGAEYQLQICVPTKLRGLQVVA
VKKLTRTQASTVCTWSQERACAYSSVQHVEEWHSVSCVIASDKENVTVAAEISWDHSEEL
LKDVTELQILGEISFNKSLYEGLNAENHRTKITVVFLKDEKYHSLPIIIKGSVGGLLVLI
VILVILFKCGFFKRKYQQLNLESIRKAQLKSENLLEEEN
Download sequence
Identical sequences P38570
ENSP00000263087 gi|148728188|ref|NP_002199.3| NP_002199.3.87134 NP_002199.3.92137 ENSP00000263087 9606.ENSP00000263087 ENSP00000263087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]