SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000263646 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000263646
Domain Number 1 Region: 23-144
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.87e-21
Family Synaptotagmin-like (S variant) 0.041
Further Details:      
 
Domain Number 2 Region: 193-243
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000655
Family CUE domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000263646   Gene: ENSG00000078902   Transcript: ENST00000263646
Sequence length 246
Comment pep:novel chromosome:GRCh37:11:1296883:1330884:-1 gene:ENSG00000078902 transcript:ENST00000263646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTVQLDAQAAQQLQYGGAVGTVGRLNITVVQAKLAKNYGMTRMDPYCRLRLGYAVYET
PTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPESLRQGKVE
DKWYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITGMPAV
CSPGMVPVALPPAAVNAQPRCSEEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAINSLL
QMGEEP
Download sequence
Identical sequences A0A2J8JVD6 A0A2J8S6V7 E7EN89
ENSP00000263646 ENSP00000263646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]