SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000263776 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000263776
Domain Number 1 Region: 77-478
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.53e-78
Family GABA-aminotransferase-like 0.0000375
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000263776   Gene: ENSG00000110455   Transcript: ENST00000263776
Sequence length 501
Comment pep:known chromosome:GRCh37:11:44087818:44105764:1 gene:ENSG00000110455 transcript:ENST00000263776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTLPQKDFRAPTTCLGPTCMQDLGSSHGEDLEGECSRKLDQKLPELRGVGDPAMISSDT
SYLSSRGRMIKWFWDSAEEGYRTYHMDEYDEDKNPSGIINLGTSENKLCFDLLSWRLSQR
DMQRVEPSLLQYADWRGHLFLREEVAKFLSFYCKSPVPLRPENVVVLNGGASLFSALATV
LCEAGEAFLIPTPYYGAITQHVCLYGNIRLAYVYLDSEVTGLDTRPFQLTVEKLEMALRE
AHSEGVKVKGLILISPQNPLGDVYSPEELQEYLVFAKRHRLHVIVDEVYMLSVFEKSVGY
RSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLCRYHGLSGLVQ
YQMAQLLRDRDWINQVYLPENHARLKAAHTYVSEELRALGIPFLSRGAGFFIWVDLRKYL
PKGTFEEEMLLWRRFLDNKVLLSFGKAFECKEPGWFRFVFSDQVHRLCLGMQRVQQVLAG
KSQVAEDPRPSQSQEPSDQRR
Download sequence
Identical sequences A0A0S2Z622 Q96QU6
ENSP00000263776 gi|14211921|ref|NP_115981.1| gi|187936925|ref|NP_001120691.1| NP_001120691.1.87134 NP_001120691.1.92137 NP_115981.1.87134 NP_115981.1.92137 ENSP00000263776 9606.ENSP00000263776 ENSP00000263776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]