SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000264128 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000264128
Domain Number 1 Region: 9-103
Classification Level Classification E-value
Superfamily EF-hand 3.01e-24
Family Polcalcin 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000264128   Gene: ENSG00000085491   Transcript: ENST00000264128
Sequence length 110
Comment pep:known chromosome:GRCh37:1:108677442:108742901:-1 gene:ENSG00000085491 transcript:ENST00000264128 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAE
EKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDALMLMGQ
Download sequence
Identical sequences J3KN42
ENSP00000264128 ENSP00000264128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]