SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000266482 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000266482
Domain Number 1 Region: 2-162
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-47
Family DBL homology domain (DH-domain) 0.00042
Further Details:      
 
Domain Number 2 Region: 145-307
Classification Level Classification E-value
Superfamily PH domain-like 8.22e-35
Family Pleckstrin-homology domain (PH domain) 0.0019
Further Details:      
 
Domain Number 3 Region: 306-381
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.01e-23
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.002
Further Details:      
 
Domain Number 4 Region: 397-439
Classification Level Classification E-value
Superfamily PH domain-like 0.000000784
Family Pleckstrin-homology domain (PH domain) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000266482   Gene: ENSG00000139132   Transcript: ENST00000266482
Sequence length 471
Comment pep:known chromosome:GRCh37:12:32655104:32791851:1 gene:ENSG00000139132 transcript:ENST00000266482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNKIFSNISSINAFHSKFLLPELEKRMQEWETTPRIGDILQKLAPFLKMYGEYVKGFDN
AMELVKNMTERIPQFKSVVEEIQKQKICGSLTLQHHMLEPVQRIPRYEMLLKDYLRKLPP
DSLDWNDAKKSLEIISTAASHSNSAIRKMENLKKLLEIYEMLGEEEDIVNPSNELIKEGQ
ILKLAARNTSAQERYLFLFNNMLLYCVPKFSLVGSKFTVRTRVGIDGMKIVETQNEEYPH
TFQVSGKERTLELQASSAQDKEEWIKALQETIDAFHQRHETFRNAIAKDNDIHSEVSTAE
LGKRAPRWIRDNEVTMCMKCKEPFNALTRRRHHCRACGYVVCWKCSDYKAQLEYDGGKLS
KVCKDCYQIISGFTDSEEKKRKGILEIESAEVSGNSVVCSFLQYMEKSKPWQKAWCVIPK
QDPLVLYMYGAPQVSKPHLSEGTDALGGKGKRVDSGLKICRTRVQAVSLFH
Download sequence
Identical sequences ENSP00000266482 NP_001291412.1.87134 NP_001291412.1.92137 XP_016779167.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]