SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000269586 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000269586
Domain Number 1 Region: 13-174
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.76e-40
Family G proteins 0.000000916
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000269586   Gene: ENSG00000141748   Transcript: ENST00000269586
Sequence length 179
Comment pep:known chromosome:GRCh37:17:37313147:37322013:-1 gene:ENSG00000141748 transcript:ENST00000269586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQLIAKLMSIFGNQEHTVIIVGLDNEGKTTILYRFLTNEVVHMCPTIGSNVEEIILPKT
HFFMWDIVRPEALSFIWNTYYSNTEFIILVIDSTDRDRLLTTREELYKMLAHEALQDASV
LIFANKQDVKDSMRMVEISHFLTLSTIKDHSWHIQGCCALTREGLPARLQWMESQAAAN
Download sequence
Identical sequences A6NH57
ENSP00000269586 ENSP00000269586 ENSP00000269586 ENSP00000387615 NP_001137440.1.87134 NP_001137440.1.92137 gi|221219071|ref|NP_001137440.1| 9606.ENSP00000269586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]