SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000275764 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000275764
Domain Number 1 Region: 52-112
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000017
Family HLH, helix-loop-helix DNA-binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000275764   Gene: ENSG00000146857   Transcript: ENST00000275764
Sequence length 330
Comment pep:known chromosome:GRCh37:7:134916731:134943244:1 gene:ENSG00000146857 transcript:ENST00000275764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKIDVDKILFFNQEIRLWQLIMATPEENSNPHDRATPQLPAQLQELEHRVARRRLSQAR
HRATLAALFNNLRKTVYSQSDLIASKWQVLNKAKSHIPELEQTLDNLLKLKASFNLEDGH
ASSLEEVKKEYASMYSGNDSFPQNGSSPWYLNFYKQTMDLLTGSGIITPQEAALPIVSAA
ISHLWQNLSEERKASLRQAWAQKHRGPATLAEACREPACAEGSVKDSGVDSQGASCSLVS
TPEEILFEDAFDVASFLDKSEVPSTSSSSSVLASCNPENPEEKFQLYMQIINFFKGLSCA
NTQVKQEASFPVDEEMIMLQCTETFDDEDL
Download sequence
Identical sequences Q7Z7C7
ENSP00000275764 ENSP00000275764 NYSGRC-32698790 ENSP00000275764 9606.ENSP00000275764 gi|32698790|ref|NP_872295.1| NP_872295.1.87134 NP_872295.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]