SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000276569 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000276569
Domain Number 1 Region: 14-79
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000946
Family Clathrin adaptor core protein 0.079
Further Details:      
 
Domain Number 2 Region: 143-202
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.000000435
Family HMA, heavy metal-associated domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000276569   Gene: ENSG00000104442   Transcript: ENST00000276569
Sequence length 282
Comment pep:known chromosome:GRCh37:8:66514694:66546442:-1 gene:ENSG00000104442 transcript:ENST00000276569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSSTSTMSEEPDALSVVNQLRDLAADPLNRRAIVQDQGCLPGLILFMDHPNPPVVHSAL
LALRYLAECRANREKMKGELGMMLSLQNVIQKTTTPGETKLLASEIYDILQSSNMADGDS
FNEMNSRRRKAQFFLGTTNKRAKTVVLHIDGLDDTSRRNLCEEALLKIKGVISFTFQMAV
QRCVVRIRSDLKAEALASAIASTKVMKAQQVVKSESGEEMLVPFQDTPVEVEQNTELPDY
LPEDESPTKEQDKAVSRVGSHPEGGASWLSTAANFLSRSFYW
Download sequence
Identical sequences A0A0D9RP64 A0A2I3LNK3 A0A2J8UR21 A0A2K5MSR4 A0A2K6M3P7 G1QUX6 G3RPG2 G7PBX8 H2QW84 I0FIL8 Q9NVT9
gi|8922479|ref|NP_060590.1| ENSGGOP00000017682 ENSGGOP00000017682 ENSP00000276569 ENSPTRP00000034740 ENSNLEP00000004746 ENSNLEP00000024018 ENSPANP00000009173 ENSP00000276569 9544.ENSMMUP00000032086 9598.ENSPTRP00000034740 9606.ENSP00000276569 ENSPTRP00000034740 ENSMMUP00000032086 NP_001248244.1.72884 NP_060590.1.87134 NP_060590.1.92137 XP_003268402.1.23891 XP_004047149.1.27298 XP_005563488.1.63531 XP_007998954.1.81039 XP_011914023.1.92194 XP_012351579.1.23891 XP_016815009.1.37143 XP_016869094.1.92137 XP_017726280.1.44346 XP_519788.2.37143 ENSMMUP00000032086 GO.34730 ENSP00000276569 ENSNLEP00000004746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]