SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000281043 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000281043
Domain Number 1 Region: 378-459
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.45e-20
Family HLH, helix-loop-helix DNA-binding domain 0.0000926
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000281043   Gene: ENSG00000134323   Transcript: ENST00000281043
Sequence length 464
Comment pep:known chromosome:GRCh37:2:16080686:16087129:1 gene:ENSG00000134323 transcript:ENST00000281043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPP
LSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGF
SAREKLERAVSEKLQHGRGPPTAGSTAQSPGAGAASPAGRGHGGAAGAGRAGAALPAELA
HPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPG
GRQTSGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNTKAVTTFTIT
VRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLK
SVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKV
VILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC
Download sequence
Identical sequences L0CUZ4 P04198
ENSP00000281043 ENSP00000281043 gi|19923312|ref|NP_005369.2| 9606.ENSP00000281043 NP_001280157.1.87134 NP_001280157.1.92137 NP_005369.2.87134 NP_005369.2.92137 XP_016859657.1.92137 ENSP00000281043 HR6419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]