SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000281471 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000281471
Domain Number 1 Region: 61-242
Classification Level Classification E-value
Superfamily RNI-like 9.61e-28
Family 28-residue LRR 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000281471   Gene: ENSG00000151743   Transcript: ENST00000281471
Sequence length 258
Comment pep:known chromosome:GRCh37:12:31824071:31882108:-1 gene:ENSG00000151743 transcript:ENST00000281471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRPRRVSQLLDLCLWCFMKNISRYLTDIKPLPPNIKDRLIKIMSMQGQITDSNISEILH
PEVQTLDLRSCDISDAALLHLSNCRKLKKLNLNASKGNRVSVTSEGIKAVASSCSYLHEA
SLKRCCNLTDEGVVALALNCQLLKIIDLGGCLSITDVSLHALGKNCPFLQCVDFSATQVS
DSGVIALVSGPCAKKLEEIHMGHCVNLTDGAVEAVLTYCPQIRILLFHGCPLITDHSREV
LEQLVGPNKLKQVTWTVY
Download sequence
Identical sequences Q8IY45
NP_001106873.1.87134 NP_001106873.1.92137 ENSP00000281471 9606.ENSP00000281471 ENSP00000281471 ENSP00000281471 gi|164663798|ref|NP_001106873.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]