SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000283474 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000283474
Domain Number 1 Region: 9-49
Classification Level Classification E-value
Superfamily UBA-like 0.00000024
Family TAP-C domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000283474   Gene: ENSG00000153443   Transcript: ENST00000283474
Sequence length 177
Comment pep:known chromosome:GRCh37:16:4658884:4664927:-1 gene:ENSG00000153443 transcript:ENST00000283474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVNMDELKHQVMINQFVLTAGCAADQAKQLLQAAHWQFETALSAFFQETNIPYSHHHHQ
MMCTPANTPATPPNFPDALTMFSRLKASESFHSGGSGSPMAATATSPPPHFPHAATSSSA
ASSWPTAASPPGGPQHHQPQPPLWTPTPPSPASDWPPLAPQQATSEPRAHPAMEAER
Download sequence
Identical sequences A0A2I2YYH8 H2QAI0 Q8TB05
ENSPTRP00000013187 gi|21687062|ref|NP_660296.1| ENSP00000283474 ENSP00000283474 ENSPTRP00000013187 ENSGGOP00000010640 NP_660296.1.87134 NP_660296.1.92137 XP_001169127.1.37143 XP_018867677.1.27298 ENSGGOP00000010640 9598.ENSPTRP00000013187 9606.ENSP00000283474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]