SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000284165 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000284165
Domain Number 1 Region: 23-104
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.6e-21
Family HLH, helix-loop-helix DNA-binding domain 0.00000739
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000284165   Gene: ENSG00000125952   Transcript: ENST00000284165
Sequence length 134
Comment pep:putative chromosome:GRCh37:14:65541920:65569206:-1 gene:ENSG00000125952 transcript:ENST00000284165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR
AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQGEHPSSWGSWPCCAPARSGFGT
WACRVRASHGVCAQ
Download sequence
Identical sequences A0A2J8PIG2 A0A2J8WLY1
ENSP00000284165 ENSP00000284165 gi|21704269|ref|NP_660092.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]