SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000284273 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000284273
Domain Number 1 Region: 385-398,429-635
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 8.68e-37
Family Cofactor-dependent phosphoglycerate mutase 0.026
Further Details:      
 
Domain Number 2 Region: 14-88
Classification Level Classification E-value
Superfamily UBA-like 1.66e-16
Family UBA domain 0.00056
Further Details:      
 
Domain Number 3 Region: 257-321
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000614
Family SH3-domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSP00000284273
Domain Number - Region: 93-220
Classification Level Classification E-value
Superfamily LigT-like 0.00022
Family Atu0111-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000284273   Gene: ENSG00000154127   Transcript: ENST00000284273
Sequence length 649
Comment pep:known chromosome:GRCh37:11:122526383:122685181:1 gene:ENSG00000154127 transcript:ENST00000284273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQYGHPSPLGMAAREELYSKVTPRRNRQQRPGTIKHGSALDVLLSMGFPRARAQKALAS
TGGRSVQAACDWLFSHVGDPFLDDPLPREYVLYLRPTGPLAQKLSDFWQQSKQICGKNKA
HNIFPHITLCQFFMCEDSKVDALGEALQTTVSRWKCKFSAPLPLELYTSSNFIGLFVKED
SAEVLKKFAADFAAEAASKTEVHVEPHKKQLHVTLAYHFQASHLPTLEKLAQNIDVKLGC
DWVATIFSRDIRFANHETLQVIYPYTPQNDDELELVPGDFIFMSPMEQTSTSEGWIYGTS
LTTGCSGLLPENYITKADECSTWIFHGSYSILNTSSSNSLTFGDGVLERRPYEDQGLGET
TPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLN
MPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAHN
ILKGLQQENHLKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPISKL
VVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQ
MVRKIPYLGFCSCEELGETGIWQLTDPPILPLTHGPTGGFNWRETLLQE
Download sequence
Identical sequences Q8TF42
gi|24497612|ref|NP_116262.2| ENSP00000284273 ENSP00000284273 NP_116262.2.87134 NP_116262.2.92137 ENSP00000284273 9606.ENSP00000284273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]