SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000291900 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000291900
Domain Number 1 Region: 390-756
Classification Level Classification E-value
Superfamily ARM repeat 2.09e-37
Family Plakophilin 1 helical region 0.014
Further Details:      
 
Domain Number 2 Region: 78-298
Classification Level Classification E-value
Superfamily RNI-like 1.39e-16
Family Cyclin A/CDK2-associated p19, Skp2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000291900   Gene: ENSG00000160445   Transcript: ENST00000291900
Sequence length 766
Comment pep:known chromosome:GRCh37:9:131492065:131534172:-1 gene:ENSG00000160445 transcript:ENST00000291900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDTPESLMALCTDFCLRNLDGTLGYLLDKETLRLHPDIFLPSEICDRLVNEYVELVNA
ACNFEPHESFFSLFSDPRSTRLTRIHLREDLVQDQDLEAIRKQDLVELYLTNCEKLSAKS
LQTLRSFSHTLVSLSLFGCTNIFYEEENPGGCEDEYLVNPTCQVLVKDFTFEGFSRLRFL
NLGRMIDWVPVESLLRPLNSLAALDLSGIQTSDAAFLTQWKDSLVSLVLYNMDLSDDHIR
VIVQLHKLRHLDISRDRLSSYYKFKLTREVLSLFVQKLGNLMSLDISGHMILENCSISKM
EEEAGQTSIEPSKSSIIPFRALKRPLQFLGLFENSLCRLTHIPAYKVSGDKNEEQVLNAI
EAYTEHRPEITSRAINLLFDIARIERCNQLLRALKLVITALKCHKYDRNIQVTGSAALFY
LTNSEYRSEQSVKLRRQVIQVVLNGMESYQEVTVQRNCCLTLCNFSIPEELEFQYRRVNE
LLLSILNPTRQDESIQRIAVHLCNALVCQVDNDHKEAVGKMGFVVTMLKLIQKKLLDKTC
DQVMEFSWSALWNITDETPDNCEMFLNFNGMKLFLDCLKEFPEKQELHRNMLGLLGNVAE
VKELRPQLMTSQFISVFSNLLESKADGIEVSYNACGVLSHIMFDGPEAWGVCEPQREEVE
ERMWAAIQSWDINSRRNINYRSFEPILRLLPQGISPVSQHWATWALYNLVSVYPDKYCPL
LIKEGGMPLLRDIIKMATARQETKEMARKVIEHCSNFKEENMDTSR
Download sequence
Identical sequences A0A024R8B0 Q7Z7L7
9606.ENSP00000291900 NP_006327.2.87134 NP_006327.2.92137 XP_005251702.1.92137 XP_011516424.1.92137 XP_016869674.1.92137 ENSP00000291900 NYSGRC-33589814 ENSP00000291900 gi|33589814|ref|NP_006327.2| ENSP00000291900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]