SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000292782 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000292782
Domain Number 1 Region: 5-47
Classification Level Classification E-value
Superfamily UBA-like 0.0000000119
Family TAP-C domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000292782   Gene: ENSG00000043093   Transcript: ENST00000292782
Sequence length 259
Comment pep:known chromosome:GRCh37:3:182655862:182698431:-1 gene:ENSG00000043093 transcript:ENST00000292782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSL
DRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQ
EFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIA
YWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLI
DDFVEFARPQIAGTKSTTV
Download sequence
Identical sequences A0A0D9RL93 A0A1S3GKH6 A0A2I3H8D9 A0A2J8WH05 A0A2K5MN47 H9EN12 I3L7H0 K7AGK0 Q96GG9
ENSP00000292782 ENSNLEP00000007243 ENSDNOP00000014794 ENSP00000292782 9606.ENSP00000292782 gi|36030883|ref|NP_065691.2| ENSSSCP00000019975 ENSP00000292782 ENSSSCP00000019975 ENSNLEP00000007243 NP_001244383.1.72884 NP_065691.2.87134 NP_065691.2.92137 XP_003256575.1.23891 XP_003358743.1.46622 XP_004278450.1.21590 XP_004406860.1.74151 XP_005546538.1.63531 XP_006869877.1.41390 XP_007468985.1.90284 XP_007934097.1.48129 XP_007970174.1.81039 XP_008264786.1.1745 XP_011736856.1.29376 XP_011944175.1.92194 XP_012383057.1.11602 XP_012592417.1.48125 XP_012888512.1.60039 XP_012888513.1.60039 XP_013216221.1.77405 XP_014442909.1.99106 XP_015993498.1.101085 XP_016797845.1.37143 XP_019801820.1.83887 XP_021548015.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]