SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000293860 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000293860
Domain Number 1 Region: 45-108
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 2.32e-23
Family Transcriptional factor domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSP00000293860
Domain Number - Region: 3-30
Classification Level Classification E-value
Superfamily RING/U-box 0.053
Family IBR domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000293860   Gene: ENSG00000161980   Transcript: ENST00000293860
Sequence length 108
Comment pep:known chromosome:GRCh37:16:96407:103628:-1 gene:ENSG00000161980 transcript:ENST00000293860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFCPGCGNGLIVEEGQRCHRFSCNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWE
NVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
Download sequence
Identical sequences Q9Y2Y1
ENSP00000293860 gi|302058278|ref|NP_057394.2| 9606.ENSP00000293860 ENSP00000293860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]