SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000294173 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000294173
Domain Number 1 Region: 71-166
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-24
Family SH2 domain 0.0000532
Further Details:      
 
Domain Number 2 Region: 210-257
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000157
Family SOCS box-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000294173   Gene: ENSG00000114737   Transcript: ENST00000348721
Sequence length 258
Comment pep:known chromosome:GRCh37:3:50643953:50649262:-1 gene:ENSG00000114737 transcript:ENST00000348721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLCVQGPRPLLAVERTGQRPLWAPSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKV
LDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCTADTRSDSPDPAP
TPALPMPKEDAPSDPALPAPPPATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDC
LPLPRRMADYLRQYPFQL
Download sequence
Identical sequences Q9NSE2
NP_659508.1.87134 NP_659508.1.92137 XP_003818850.1.60992 HR6374 ENSP00000294173 ENSP00000294173 gi|21614507|ref|NP_659508.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]