SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Homo sapiens 75_37 > ENSP00000294904

Domain assignment for ENSP00000294904 from Homo sapiens 75_37

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSP00000294904
Domain Number 1	Region: 29-123
Classification Level	Classification	E-value
Superfamily	RNA-binding domain, RBD	1.11e-23
Family	Canonical RBD	0.0000845
Further Details:

Domain Number 2	Region: 131-248
Classification Level	Classification	E-value
Superfamily	RNA-binding domain, RBD	5.1e-20
Family	Canonical RBD	0.0000133
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSP00000294904 Gene: ENSG00000153250 Transcript: ENST00000348849
Sequence length	406
Comment	pep:known chromosome:GRCh37:2:161128662:161350305:-1 gene:ENSG00000153250 transcript:ENST00000348849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MGKVWKQQMYPQYATYYYPQYLQAKQSLVPAHPMAPPSPSTTSSNNNSSSSSNSGWDQLS KTNLYIRGLPPHTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAV SALKASGVQAQMAKQQEQDPTNLYISNLPLSMDEQELENMLKPFGQVISTRILRDSSGTS RGVGFARMESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFADGGQKKRQNPNKYIPN GRPWHREGEVRLAGMTLTYDPTTAAIQNGFYPSPYSIATNRMITQTSITPYIASPVSAYQ VQSPSWMQPQPYILQHPGAVLTPSMEHTMSLQPASMISPLAQQMSHLSLGSTGTYMPATS AMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQPNK
Download sequence
Identical sequences	A0A2I3HSS6 K7B898 P29558 ENSP00000294904 9598.ENSPTRP00000021489 9606.ENSP00000294904 gi\|8400718\|ref\|NP_058520.1\| ENSNLEP00000002238 NP_058520.1.87134 NP_058520.1.92137 XP_009441845.1.37143 XP_012351953.1.23891 ENSP00000294904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]