SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000296181 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000296181
Domain Number 1 Region: 133-381
Classification Level Classification E-value
Superfamily vWA-like 7.89e-82
Family Integrin A (or I) domain 0.0000000228
Further Details:      
 
Domain Number 2 Region: 377-466
Classification Level Classification E-value
Superfamily Integrin domains 5.18e-30
Family Integrin domains 0.0001
Further Details:      
 
Domain Number 3 Region: 633-715
Classification Level Classification E-value
Superfamily Integrin beta tail domain 9.15e-19
Family Integrin beta tail domain 0.00033
Further Details:      
 
Domain Number 4 Region: 26-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000167
Family Plexin repeat 0.00067
Further Details:      
 
Domain Number 5 Region: 592-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000106
Family Integrin beta EGF-like domains 0.0032
Further Details:      
 
Domain Number 6 Region: 549-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Weak hits

Sequence:  ENSP00000296181
Domain Number - Region: 518-549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0391
Family Integrin beta EGF-like domains 0.031
Further Details:      
 
Domain Number - Region: 474-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0781
Family Integrin beta EGF-like domains 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000296181   Gene: ENSG00000082781   Transcript: ENST00000296181
Sequence length 799
Comment pep:known chromosome:GRCh37:3:124480795:124606144:-1 gene:ENSG00000082781 transcript:ENST00000296181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRAPAPLYACLLGLCALLPRLAGLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSI
TSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRP
GDKTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFG
SFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVS
RNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQC
HLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEIL
DGDSKNIIQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGD
TASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSG
TYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREAEGKPLCSGRGDCSCNQCSCFESEF
GKIYGPFCECDNFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCRGRDGQ
ICSERGHCLCGQCQCTEPGAFGEMCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSL
CRDEVITWVDTIVKDDQEAVLCFYKTAKDCVMMFTYVELPSGKSNLTVLREPECGNTPNA
MTILLAVVGSILLVGLALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPIST
HTVDFTFNKFNKSYNGTVD
Download sequence
Identical sequences L7RT22 P18084
gi|20127446|ref|NP_002204.2| ENSP00000296181 ENSP00000296181 9606.ENSP00000296181 ENSP00000296181 NP_002204.2.87134 NP_002204.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]