SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000299297 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000299297
Domain Number 1 Region: 71-192
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.42e-16
Family SepSecS-like 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000299297   Gene: ENSG00000166224   Transcript: ENST00000299297
Sequence length 202
Comment pep:known chromosome:GRCh37:10:72604254:72620243:1 gene:ENSG00000166224 transcript:ENST00000299297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWTLLIVWGYEFVFQPESLWSRFKKKCFKL
TRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMD
AFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFN
GGPDSCGCEALFLFCFSNMLAP
Download sequence
Identical sequences H7BXL7
ENSP00000299297 ENSP00000299297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]