SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000300057 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000300057
Domain Number 1 Region: 81-152
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000123
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000300057   Gene: ENSG00000166823   Transcript: ENST00000300057
Sequence length 268
Comment pep:known chromosome:GRCh37:15:90291892:90294541:-1 gene:ENSG00000166823 transcript:ENST00000300057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQPLCPPLSESWMLSAAWGPTRRPPPSDKDCGRSLVSSPDSWGSTPADSPVASPARPGT
LRDPRAPSVGRRGARSSRLGSGQRQSASEREKLRMRTLARALHELRRFLPPSVAPAGQSL
TKIETLRLAIRYIGHLSAVLGLSEESLQRRCRQRGDAGSPRGCPLCPDDCPAQMQTRTQA
EGQGQGRGLGLVSAVRAGASWGSPPACPGARAAPEPRDPPALFAEAACPEGQAMEPSPPS
PLLPGDVLALLETWMPLSPLEWLPEEPK
Download sequence
Identical sequences Q9BRJ9
ENSP00000300057 NP_061140.1.87134 NP_061140.1.92137 9606.ENSP00000300057 ENSP00000300057 ENSP00000300057 gi|14149724|ref|NP_061140.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]